PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G096300.1.p
Common NameSb03g008090, SORBIDRAFT_03g008090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 816aa    MW: 86894.2 Da    PI: 5.153
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G096300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox702.9e-22107162156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe+lF+++++p++++r eL+k+lgL+ rqVk+WFqNrR+++k
  Sobic.003G096300.1.p 107 KKRYHRHTPQQIQELEALFKECPHPDEKQRGELSKRLGLDPRQVKFWFQNRRTQMK 162
                           678899***********************************************999 PP

2START182.32.7e-573255571206
                           HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S CS
                 START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...........dsgealrasgvvdmvla.llveellddkeqWdetla 77 
                           ela +a++elvk+a+ +ep+W  s  +++++e l  +e +++           + +ea+r+sg+v+ +    lve+l+d + +W+ ++ 
  Sobic.003G096300.1.p 325 ELAISAMDELVKLAQIDEPLWLPSLNGSPNKELLNFEEYAHSflpcvgvkpvgYVSEASRESGLVIFDNSlALVETLMDER-RWSDMFS 412
                           57889********************555555555555555555666679**************997655548999999999.******* PP

                           ....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE..-TTS--....-TTSEE-EESSE CS
                 START  78 ....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpS 150
                               ka++le ++sg      g l lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    +++ +R+++lpS
  Sobic.003G096300.1.p 413 cmiaKATVLEEVTSGiagsrnGGLLLMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDglVRDQNSAtasNAGNIRCRRLPS 501
                           ****************************************************************954333443367899********** PP

                           EEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 151 giliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           g+++++++ng++kvtwveh++++++++h+l+r+l++sgla+ga++w+a lqrqce+
  Sobic.003G096300.1.p 502 GCVMQDTPNGYCKVTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLAMLQRQCEC 557
                           ******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2392164IPR009057Homeodomain-like
SuperFamilySSF466891.42E-2195164IPR009057Homeodomain-like
PROSITE profilePS5007118.285104164IPR001356Homeobox domain
SMARTSM003892.8E-21105168IPR001356Homeobox domain
CDDcd000864.54E-20106164No hitNo description
PfamPF000469.7E-20107162IPR001356Homeobox domain
PROSITE patternPS000270139162IPR017970Homeobox, conserved site
PROSITE profilePS5084847.097316560IPR002913START domain
SuperFamilySSF559615.5E-31318557No hitNo description
CDDcd088753.60E-113320556No hitNo description
SMARTSM002341.3E-45325557IPR002913START domain
PfamPF018524.8E-50326557IPR002913START domain
SuperFamilySSF559611.15E-21577784No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MSFGSLFDGG AGGGGGGGMQ FPFSTGFSSS PALSLGLDNA GGGGMVGRML PGGAGAGAAA  60
DGGGMMMGRD ADAENDSRSG SDHLDAMSAG GAEDEDDAEP GNPRKRKKRY HRHTPQQIQE  120
LEALFKECPH PDEKQRGELS KRLGLDPRQV KFWFQNRRTQ MKTQLERHEN ALLKQENDKL  180
RAENMAIREA MRSPMCGSCG SPAMLGEVSL EEQHLCIENA RLKDELSRVY ALATKFLGKP  240
MSILSAGTML QPNLSLPMPS SSLELAVGGG LRGLGSIPSA ATMPGSMGDF AGGVSSPLGT  300
VITPARTTGS APPPMVGIDR SMLLELAISA MDELVKLAQI DEPLWLPSLN GSPNKELLNF  360
EEYAHSFLPC VGVKPVGYVS EASRESGLVI FDNSLALVET LMDERRWSDM FSCMIAKATV  420
LEEVTSGIAG SRNGGLLLMK AELQVLSPLV PIREVTFLRF CKQLAEGAWA VVDVSIDGLV  480
RDQNSATASN AGNIRCRRLP SGCVMQDTPN GYCKVTWVEH TEYDEASVHQ LYRPLLRSGL  540
AFGARRWLAM LQRQCECLAI LMSPDTVSAN DSSVITQEGK RSMLKLARRM TENFCAGVSA  600
SSAREWSKLD GAAGSIGEDV RVMARKSVDE PGEPPGVVLS AATSVWVPVA PEKLFNFLRD  660
EQLRAEWDIL SNGGPMQEMA NIAKGQEHGN SVSLLRASAM SANQSSMLIL QETCTDASGS  720
MVVYAPVDIP AMQLVMNGGD STYVALLPSG FAILPDGPSG VGAEHKTGGS LLTVAFQILV  780
NSQPTAKLTV ESVETVNNLI SCTIKKIKTA LQCDA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102108PRKRKKR
2103107RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.201210.0panicle
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632490.0BT063249.1 Zea mays full-length cDNA clone ZM_BFc0042P14 mRNA, complete cds.
GenBankBT0644530.0BT064453.1 Zea mays full-length cDNA clone ZM_BFc0170E20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457484.10.0hypothetical protein SORBIDRAFT_03g008090
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLC5XEA60.0C5XEA6_SORBI; Putative uncharacterized protein Sb03g008090
STRINGSb03g008090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1